DPCstruct | MC35882
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 170 ± 15 aa |
| Standard deviation of domain lengths | 14.76 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 77.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P4PZ89 | 499-658 | VNAVNHACSALWHLYDRRDDPAGLQKQQEYENLVHRTERLIRQFIKKRPAIWRLIDVRYDVMASLIKGRRIRLIQKILNNEESNPWM… |
| A0A397TUE1 | 1-156 | MNVVKYACYSLKYLSSYKKFELWFELHKSKVTYIIEQTRKIILRFIRLHPTEWRLLDIRYDLMSVLIEAKEYELVKYILSSKEQLHI… |
| A0A372QF88 | 1-157 | None |
| A0A015LVQ6 | 543-693 | None |
| U9TLX0 | 111-267 | None |
| U9UWW5 | 21-199 | None |
| A0A397J409 | 228-380 | None |
| A0A397IVF9 | 138-303 | None |
| A0A2Z6RMC9 | 242-421 | None |
| A0A2I1EAW9 | 349-522 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.