DPCstruct | MC35880
Metacluster Properties and Pfam Annotations
| Number of structural domains | 102 |
|---|---|
| Mean domain length (aa) | 206 ± 37 aa |
| Standard deviation of domain lengths | 36.79 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 76.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 30.64 |
| Pfam Score | 99.36 |
| Assigned Pfam label(s) | PF03169- CL0523 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397TR03 | 53-278 | NSEDNSVNELISAAANVNDDPSLPCLTFRFWVLSTFFTVLGAAISVFYYFRSNYLNYSIFFVILLSYTAGKWMEKMLPTRRFRIKNW… |
| A0A4D9C3Q9 | 23-234 | ENSPVEQVALTVPPTDDPSLPVVTFRMWILGAAACVLLSFLNQFFWYRREPLSISSISAQIAVVPLGHLLAAALTRRVFFPGRRWEF… |
| E3KXH7 | 61-234 | None |
| A0A444C9B9 | 386-547 | None |
| A0A0G4NL58 | 111-352 | None |
| A0A6A2XSJ1 | 21-180 | None |
| M0ZW46 | 2-217 | None |
| A0A177U433 | 81-294 | None |
| A0A7D8UQZ9 | 55-249 | None |
| A0A1S8VCU1 | 22-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.