DPCstruct | MC35869
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 144 ± 23 aa |
| Standard deviation of domain lengths | 23.41 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 14.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A374W5E1 | 1-124 | MPLSKARVEDYPGSSYITFISGIWTRINFSKADFKEKQSGNGELIEQTFEATITNTDSDNEAILQAVVSELGFLRIDYTNGGIKVAG… |
| A0A3N2KQ60 | 4-103 | LGSEDDAVAVPGSVKVSTTSDNGIIKKKITFERSDVSDSTADALEGYKVSRLIATYVDESGKRRVAGSPDWPLSLDYSIGDGVFSVT… |
| A0A3R8UEX7 | 3-148 | None |
| G8R3S3 | 50-209 | None |
| A0A496P2M7 | 6-140 | None |
| A0A519TM08 | 136-298 | None |
| A0A4Q8RTX9 | 82-229 | None |
| A0A7Y0YPL3 | 1-96 | None |
| A0A3D5AAD6 | 3-138 | None |
| A0A316RDL5 | 3-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.