DPCstruct | MC35868
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 5.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 89.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09533 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y6XB06 | 125-214 | TKPREKHHIFPQEFKDWFERQGINIHKETMLIDIDTHHRIHRGFSGGPWNGEWRKFRDNHTGATQEDMYRYAREMIIRFDLVGPILP… |
| A0A6I7G0Z8 | 5-101 | ATKVADHHIFPKFRGNDKYAKFFKEKGINVDDFTVTLAHGKDSHHLKFIHGQGKWNETWKAWIDANPNATAKEIFQQAGKMMDEYGL… |
| A0A511TGD7 | 3-102 | None |
| A0A2T4VE35 | 157-244 | None |
| A0A085WUH8 | 17-107 | None |
| A0A085W5R4 | 1-88 | None |
| B0YR29 | 140-231 | None |
| A0A511SUB3 | 189-282 | None |
| A0A3N1YM37 | 33-110 | None |
| A0A250J6A0 | 43-126 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.