DPCstruct | MC35865
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 221 ± 36 aa |
| Standard deviation of domain lengths | 35.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 30.42 |
| Pfam Score | 87.83 |
| Assigned Pfam label(s) | PF01502- CL0231- CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D4J3A9 | 54-277 | MQMKSDLSDNGIKMDNFEPKLSWSDLKPNADGLVPTVIQDFQTGEVLMMAYMNEESFNTTIRTGKMTYYSRSRQSLWVKGETSGHFQ… |
| A0A6D0EMI7 | 1-134 | GHFLNVVSITPDCDNDTLLVLVNPIGPTCHLGTSSCFGEASHQWLFLYQLEQLLAERKTADPDSSYTAKLYASGTKRIAQKVGEEGV… |
| A0A3S3MYT9 | 209-431 | None |
| A0A4Y9ZN14 | 136-378 | None |
| A0A094A240 | 135-379 | None |
| A0A7J2RA24 | 9-200 | None |
| A0A820YT54 | 105-288 | None |
| A0A835UE39 | 66-304 | None |
| A0A0D9UZM1 | 64-326 | None |
| A0A7T5JU54 | 33-336 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.