DPCstruct | MC3586
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 100 ± 10 aa |
| Standard deviation of domain lengths | 9.55 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 47.73 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14224 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q7ID19 | 200-295 | LRLNMAIPPNTSNPSRLGIVGGDLAGFPNGRRVLDDVIDIELRAIAGATLPLVDNAFTPDGAAGLVADGVDSNPVQSPNSTPFLSTF… |
| A0A7W1JV77 | 10-109 | PKNVEASEMLRLNMMIPTCEPGSCADYSPLGVIGGDIAGFPNGRRLADDVIDISLQVVEGELIGNPNDLGDGVNQNDKPFLSSFPYL… |
| A0A561TUF5 | 1-88 | None |
| A0A7W0H935 | 7-109 | None |
| A0A7W9HG66 | 29-147 | None |
| A0A6F8XXR5 | 218-326 | None |
| A0A7V9FQJ3 | 112-202 | None |
| A0A7V3FD30 | 70-164 | None |
| A0A7V8WWW0 | 136-225 | None |
| A0A838GRM3 | 10-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.