DPCstruct | MC35857
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 224 ± 34 aa |
| Standard deviation of domain lengths | 33.83 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 67.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.47 |
| Pfam Score | 65.00 |
| Assigned Pfam label(s) | CL0020- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M5C2S5 | 200-410 | AGARRHKKADSKSMDVVPPDVRLPIALHNPVGSSITIEYDDALEGRMCLDLSPHDYLVELGFEALARVVPADEGWRVRKSWLEKRWG… |
| A0A7F8R4A4 | 1-275 | MSATMPRPSTPLDSVGTPKPLSKLLGSLDEVVLFSPVPELRDSSKLHDSLYNEDCTFQQLGTYIHSIRDPVRNRVTLELSNGSMVRI… |
| E9FR94 | 1-230 | None |
| A0A287FU60 | 315-511 | None |
| A0A287FTX9 | 68-280 | None |
| A0A1D6M2K7 | 392-601 | None |
| A0A5D3CRA6 | 23-219 | None |
| A0A7J6UU72 | 1-160 | None |
| A0A2G8JLN8 | 353-586 | None |
| A0A3N0XNX1 | 510-780 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.