DPCstruct | MC35856
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 113 ± 19 aa |
| Standard deviation of domain lengths | 18.76 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 85.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7F8R2K1 | 4-99 | SSAFEVLALDGISTGILRFHTAQESADWLRAVSANISDLTRQRVRTENKCSSPCDQVVHMGWVSERLEGTGSCHTFRSKFLALKGSS… |
| A0A423T0E7 | 100-197 | QAFEVRGINGISTGVVHCEDAAMLSQWIKHITNNIIGLTNLQMKLYNSSFPASEHVLYMGWVCEGVLNQNLPWQNWKPKFIALKGTD… |
| A0A6A7G7B0 | 29-161 | None |
| A0A6V7VNF3 | 101-193 | None |
| A0A7J7A4D5 | 524-650 | None |
| A0A6P5CV17 | 66-168 | None |
| A0A3Q0IXJ5 | 141-239 | None |
| J9EBJ9 | 33-171 | None |
| F6ZXK6 | 136-252 | None |
| K1P5K7 | 102-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.