DPCstruct | MC35852
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 127 ± 17 aa |
| Standard deviation of domain lengths | 16.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 21.06 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4B800 | 7-117 | VIPEHASVANAVGAVVGNVSASVTAQIRPDPVSAENFCVITQETSAVFSDYDESMAYAREQIEKTAEELLIQKGGKPPFSTSFSQNK… |
| A0A832TDS3 | 98-232 | MVVGTGYLAQFLVPRIARHSGASFTIPPHAECANAVGVAVSRVTLTLHARFDSGRGAVVFNGEPQELRTLGDDEAVLDRCRAEVKQR… |
| A0A1V4YHH6 | 148-287 | None |
| A0A7K4A8A7 | 84-226 | None |
| A0A7X9HE79 | 272-405 | None |
| A0A396R2I1 | 3-94 | None |
| A0A1V5E5K8 | 109-255 | None |
| A0A1V5NK74 | 127-259 | None |
| A0A6G2JU45 | 3-96 | None |
| A0A7X6UA37 | 305-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.