DPCstruct | MC3585
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 89 ± 16 aa |
| Standard deviation of domain lengths | 15.91 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 89.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 49.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484YQN7 | 46-157 | VPDIQAIDNRIETSHTAWQDWVNGLKYDGLYKDHVIRSALALKFLWYSPTGALAAAATTSLPEGIGGEKNYDYRFAWVRDACLIIKA… |
| A0A7W1IU18 | 100-171 | LEDTQECWESWSTLHQSYEGRFASEIRRSSLVLQGLTFKPSGAIVAAATTSLPERMGGELNFDYRYAWLRDL |
| A0A2D5SIM5 | 44-108 | None |
| A0A2N0M8T7 | 3-116 | None |
| A0A5K1JVA5 | 202-279 | None |
| A0A6G3VJR3 | 7-77 | None |
| A0A2V7ZXC3 | 181-272 | None |
| A0A4Y3W9Y7 | 76-167 | None |
| A0A4Y3UIL7 | 200-311 | None |
| A0A1E3JAV1 | 288-368 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.