DPCstruct | MC35849
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 191 ± 27 aa |
| Standard deviation of domain lengths | 26.96 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 90.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 20.16 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09375 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Z8N6Q0 | 1-152 | MLSNICDNYIVPAYTNFNEKNIALSNSLSLFSSNPTVDAFEALKQTWKDALLSWQQVCFLDFGPAAFVILNNQVNLHPVDTDVVNNN… |
| A0A136NMR4 | 2-181 | IKLKTTLALFILSIAFVSCKKDDSSDKDFTNKEILNDFSINVAQGTYNDLNEKANLLYNGIDALASNPTSTQLEQCRQLWKDSRKAW… |
| A0A257ZTL0 | 51-228 | None |
| A0A420E5G0 | 2-183 | None |
| A0A2E6GUD0 | 18-180 | None |
| A0A358JLQ9 | 116-314 | None |
| A0A7V8TTV4 | 51-320 | None |
| A0A656GQY6 | 1-197 | None |
| A0A2G6LHD5 | 49-261 | None |
| A0A812JUT8 | 1-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.