DPCstruct | MC35842
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 304 ± 28 aa |
| Standard deviation of domain lengths | 28.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 49.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817D8F2 | 1-324 | MGDFTYDVVLTLRDLGKGLGVTMPWITQSDDLIQSKVEEKLGLHVYPRPPDFPSELFRRWIVFNAREQKFQVVKGITIEILRKLINV… |
| A0A815AU48 | 122-409 | LKSNDFTLMQSHLGLTFQEHFSYDIVFSIENLRDALSLKSDEARDMVQAIIEEKLGIYTRSDWQEKEFFKHWIIFNARKQELEVVYG… |
| A0A814U8W0 | 116-403 | None |
| A0A820VXM0 | 2-257 | None |
| A0A819T7B1 | 96-433 | None |
| A0A817N5W3 | 122-408 | None |
| A0A819MLA7 | 121-471 | None |
| A0A818CP49 | 151-441 | None |
| A0A814VCC6 | 120-434 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.