DPCstruct | MC35837
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 159 ± 21 aa |
| Standard deviation of domain lengths | 20.77 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 84.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 41.33 |
| Pfam Score | 92.54 |
| Assigned Pfam label(s) | PF00521- CL0413- PF16898 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817CBT0 | 290-442 | TAKEAKEYFSNMDRHRIIFKYDSIKDDLAIQLAFNSALSDDRKDWIKWHTEDINQRREQNLPADYLYKKDTKQINFNDFINKELVLF… |
| A0A7R9JH90 | 1-142 | MSRHRIKFKYAGPQDDANITMAFSKKCIDDRKVWLTNWMEDTKRRHEMGLPEQYLYEKDTKQVNYSDFVNKELVLFSNMDNERSIPS… |
| A0A816VFU0 | 8-140 | None |
| A0A0R3Q3X3 | 364-547 | None |
| A0A250XKH7 | 499-673 | None |
| A0A453PC30 | 68-219 | None |
| A0A453PC23 | 280-462 | None |
| A0A6P8WQY5 | 583-766 | None |
| A0A817FQN4 | 1-129 | None |
| A0A820PZH8 | 1-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.