DPCstruct | MC35835
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 479 ± 41 aa |
| Standard deviation of domain lengths | 40.96 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 41.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817BMZ4 | 1-535 | MDGKTTTTSDIILFLSVINGSFILHCEDLTMLRFCLATYINIVKHFRHIFATNGYLLIMPTFLHVYSHTQSNPMLRKAIEYCCRQFY… |
| A0A1I8AAC8 | 1-402 | MYFGEMGEQLKAIDAMHKFVWVNLISDMFSKMENAFMFGDLHLFINVINGVMIIHCEDILLLRRCMATYLNIAIHFNTLFASQGFFL… |
| A0A177B7Z4 | 473-974 | None |
| A0A1S0TPT1 | 1-448 | None |
| A0A182EJT9 | 210-627 | None |
| A0A182EDI4 | 244-756 | None |
| A0A7J6CXI1 | 73-564 | None |
| A0A3P7PXA0 | 584-1103 | None |
| A7SML6 | 250-705 | None |
| A0A183IXU6 | 106-609 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.