DPCstruct | MC3583
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 181 ± 23 aa |
| Standard deviation of domain lengths | 23.23 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 78.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 19.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E0L912 | 6-140 | IWMMGMVLLLTALPVWAKGQSDRIVLTGPTIDGEVIVSNPQMVALLSMGRLEDFNQRVDQPALTEDAPYYELERQYEIPAGRFQTFD… |
| A0A7W1HS38 | 26-239 | GDGVKRLMAVAGAVLLISSVATSAGAKGATEATIRGPGLEEPLTFSGYGESANDVSLLAEQSGFFPAMFGQIPDPMEDNRPQKNLGL… |
| A0A6L5FZU6 | 3-170 | None |
| A0A2V7GZM2 | 1-165 | None |
| A0A538AJL1 | 2-194 | None |
| A0A3M1YWY2 | 1-171 | None |
| A0A537XPS9 | 13-207 | None |
| A0A2D6N352 | 19-190 | None |
| A0A538B2W3 | 9-155 | None |
| A0A170XT85 | 8-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.