DPCstruct | MC35829
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 199 ± 32 aa |
| Standard deviation of domain lengths | 31.51 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.94 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14684 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D5FA25 | 357-532 | IDWEQLTNRLWQVPVSPGNYSDLAANAKYLYVRDQVTEPGSKPVLKAIEQTPHHKTSTFMSGLSSYKLSADGKSMLMLKQSGNNDQI… |
| A0A0K2R134 | 1-239 | MVRVDPAGLAHRVIGVPVPQGNYTSLTATEGALLWLDWALAGVTGDGKASQEDKDARPSLVRFDLARRKSATLVEALDSYRLSGDGK… |
| W4TSD6 | 1-268 | None |
| A0A0H3ZVT0 | 315-497 | None |
| A0A7C5SI38 | 300-468 | None |
| A0A127QYP7 | 1-158 | None |
| A0A257LTM6 | 486-691 | None |
| A0A6I5H4B1 | 571-750 | None |
| A0A7V5H4S0 | 372-607 | None |
| A0A0B8QE48 | 13-235 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.