DPCstruct | MC35827
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 153 ± 11 aa |
| Standard deviation of domain lengths | 10.74 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 84.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535KUX3 | 44-185 | ALPASVIERDVISARVGNYASRLLDELVSMGEVVWTGRGSLGTSDGRVALYLRGDAPRLIAPPVDPPQSELHEKIRAHLKGRGASFF… |
| A0A7W1R6N7 | 638-785 | AVVASTLEPDVLAIRVDSYRATMLDELCTGGDVVWIGAGSIGARDGRVRLCFVDQLPSLAPLWDELSAPDGTLHDAVRQHLGVNGAS… |
| A0A2V8KAQ9 | 116-274 | None |
| A0A2V5Z2N8 | 15-176 | None |
| A0A7Y5GIC5 | 281-441 | None |
| A0A516TMS4 | 215-358 | None |
| A0A7J0CB78 | 5-167 | None |
| A0A538ENW1 | 2-135 | None |
| A0A376LNB0 | 11-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.