DPCstruct | MC35826
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 285 ± 66 aa |
| Standard deviation of domain lengths | 65.78 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 82.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 19.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0179 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2QWX1 | 4-246 | DHFVVDPLTGRVLERRLGDKRIAVRSIPGGGTRTLATSNGGAAACLTDKQAAELAALGHRVEGHFGSPQDIEWAIAGDGHFWLTQSR… |
| A0A824U0J5 | 2-331 | KNSNAGAFLSLANIKADSKDELLKALYEVANSMPSKSDEILVQPMLENITLCGVGFSVDKDNFSPYFCLQYDENGSNSSITDGSSKS… |
| A0A7R9Q5T6 | 7-259 | None |
| A0A1V5BU58 | 35-288 | None |
| A0A1F6CKH0 | 3-331 | None |
| A0A0K2RID4 | 7-240 | None |
| A0A135VT78 | 189-541 | None |
| A0A4V2AL41 | 1-443 | None |
| F9EFE7 | 211-479 | None |
| A0A4R3MR73 | 16-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.