DPCstruct | MC35825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 67 ± 3 aa |
| Standard deviation of domain lengths | 3.03 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 91.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 43.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K2RG16 | 1-69 | MKFNARRKVWTLAATLPAGFYTYKIALNRSWDENYGAFGARDGANHELKHDGGKVTFTYDHATRDIVTA |
| A0A0K2QWJ8 | 1-62 | MWKLSPLALPAGTYEFKAALDRGWAENYGADGVPNGGNISYTHDGGPVTFRYDHVTHVLTAG |
| A0A849BPX9 | 1200-1268 | None |
| A0A3M1XYK4 | 447-513 | None |
| A0A7M1R2V5 | 1-70 | None |
| A0A542IXM6 | 905-966 | None |
| N0DY43 | 68-130 | None |
| A0A1G8ME31 | 120-188 | None |
| A0A2N1Y0U9 | 284-351 | None |
| A0A7X7TIW8 | 141-210 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.