DPCstruct | MC3582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 367 ± 65 aa |
| Standard deviation of domain lengths | 65.26 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 81.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6UT99 | 48-428 | GISLAKSLAPWVLGALAVVLLPALVVAGLLDRSARSRQRVSTGRRRRSLLGFVATTVMAAPAAAFLAGVLPWWQAGQPWPALVLTIL… |
| A0A7W1GJB1 | 42-407 | LGSIPVRDAQVRVTRLERRFEQLHSGRRWANVMLAAFTIAAILGALLLRTRFAGRFCVAIAPAIVVVSLVLSLGGAARPVVILPVLG… |
| A0A0X8K1X9 | 17-539 | None |
| A0A7W0L4A7 | 2-255 | None |
| A0A1H1R1D9 | 2-294 | None |
| A0A317QQK1 | 193-598 | None |
| A0A7C4V2T4 | 32-334 | None |
| A0A832FKS6 | 108-494 | None |
| C4RHX4 | 189-610 | None |
| A0A4Q3UA20 | 24-429 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.