DPCstruct | MC35816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 169 ± 19 aa |
| Standard deviation of domain lengths | 18.94 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 41.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF21026 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7WFC8 | 18-181 | PDGITMKPESLCKELFSEHSELEYLLQEETGSSQGILIISRSWAIDIGLSGNSDVVCDALLIAVGSHPILYTICKDVNNVFAYSKAT… |
| A0A6I9M2Z4 | 371-541 | TKAMECKETLQRHLFPVTQANLQFQPESLCKKLFSDHQGLEDLLKAQTHPCSHGIVIVSRSWAGDIGLTKEQNVLCDALLVAANSPL… |
| A0A096MK07 | 474-628 | None |
| A0A1L1SUL4 | 1-209 | None |
| A0A835ZZT6 | 740-908 | None |
| A0A3L7GLU1 | 333-504 | None |
| I7G2S7 | 278-420 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.