DPCstruct | MC35815
Metacluster Properties and Pfam Annotations
| Number of structural domains | 127 |
|---|---|
| Mean domain length (aa) | 116 ± 23 aa |
| Standard deviation of domain lengths | 23.26 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 32.50 |
| Pfam Score | 97.97 |
| Assigned Pfam label(s) | CL0159- PF04148- CL0267- CL0303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G3I6W8 | 33-148 | PQGVGRRYAHVVLRKADIDLTKRAGELTEDEVERVITIMQNPRQYKIPDWFLNRQKDVKDGKYSQVLANGLDNKLREDLERLKKIRA… |
| A0A3M2SVA0 | 3-74 | IHPTCKVGDLANKQILDLNAALSEMRIENDLRRKVLDDIRRLRESGSNRGRRHALGLPVHGQSTRTNHKTAV |
| A0A212CM12 | 5-95 | None |
| A0A1I8F228 | 17-153 | None |
| A0A396HN26 | 1-70 | None |
| A0A3P6DF52 | 1-70 | None |
| A0A6P5MYG1 | 28-112 | None |
| A0A6M3X264 | 6-113 | None |
| A0A1E5UNM4 | 1-87 | None |
| A0A519D8Z9 | 9-109 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.