DPCstruct | MC35812
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 318 ± 68 aa |
| Standard deviation of domain lengths | 68.04 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 78.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.34 |
| Pfam Score | 90.24 |
| Assigned Pfam label(s) | PF08337- CL0072 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H2I224 | 2-218 | VTEIYLTRLLMMKGTLAKFITDLLESIFSSRNVPPCIKYMFDFMDEQAREHAINDPEVVHAWKSNALPLRFWVNLIKNPHFLFDIQK… |
| G3HWR4 | 12-365 | SDLKDSAGEPLYKLFKAIKHQVERGPVDAVQKAAKYTLNDTGLLGDDVEYSPLTVSVIIQDEGVEAIPVKVLNCDTISQVKEKIIEQ… |
| A0A3B3QIQ7 | 183-387 | None |
| A0A183MQA4 | 706-961 | None |
| H3A2E1 | 39-411 | None |
| A0A7M7HNM1 | 15-279 | None |
| A0A816UWJ5 | 51-548 | None |
| A0A2B4SHF4 | 410-771 | None |
| A0A5J5CEK7 | 316-700 | None |
| S4RGT4 | 1-300 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.