DPCstruct | MC35810
Metacluster Properties and Pfam Annotations
| Number of structural domains | 77 |
|---|---|
| Mean domain length (aa) | 118 ± 23 aa |
| Standard deviation of domain lengths | 22.58 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 71.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.40 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0351- PF07802 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S0TTC1 | 1-116 | MEDDGNGDVIHKLTREEYNEPIQDAYVESMARMSYAELDDKYNPGPTLPDGTVNFECHCVGHLVASPCGHEFREAIKCQKSAGEAAL… |
| G3HQ50 | 22-130 | SPSTAELVVDDPNDPYAEYGLVLPNGEINWNCPSLGGMASGPCGEQFKSAFSCFHYSTDELKGSDCIHQFQAMQECMKKYPDLYPRE… |
| A0A0D0ASE8 | 85-229 | None |
| A0A1E4T4E9 | 51-200 | None |
| J9EW99 | 22-153 | None |
| A0A6G3MNC9 | 1-89 | None |
| A0A4Y9ZKQ7 | 46-195 | None |
| V4ARA3 | 5-114 | None |
| A0A2J7PP00 | 22-120 | None |
| A0A2G3CEY3 | 1-181 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.