DPCstruct | MC3581
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 204 ± 15 aa |
| Standard deviation of domain lengths | 15.31 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 13.84 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09577 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W6AUB7 | 20-220 | THSYAQGTDLKTVMKNLQSAAADLVRETSFEDKAGETAAFKAFSDLFMANEAAIRAKSATAASNIDAAMTALGSALQAGDAEKAKTE… |
| K1YFE9 | 6-188 | ERTDILFDAMSPYEDLTESALSQDEQGVEKTLKTLETSSEKIKNFLSHKAVQDLNENIEKMKTAKENANFQLIALCAIDSYKTISEE… |
| A0A1M5X933 | 23-259 | None |
| V9G4E6 | 21-225 | None |
| A0A7W6A2H8 | 31-234 | None |
| A0A143BAE7 | 19-212 | None |
| A0A1B1N0A2 | 36-239 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.