DPCstruct | MC35801
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 248 ± 23 aa |
| Standard deviation of domain lengths | 23.43 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 84.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 28.81 |
| Pfam Score | 92.86 |
| Assigned Pfam label(s) | CL0182- PF01970 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G7AQK1 | 2-251 | IVLVLLGGVRMKAHRAGLIGLLAASLVAWLAYRMPVGQTLSSAAHGAVFGLFPILWIVVNALWLYRMTVRARHFDVLRRSFGRLSDD… |
| A0A151ANH2 | 15-252 | WLIIGLSKIKMQGYKACSITLIITFILAIAFWKLNPGYAATAALEGILNALWPICLVIIAALFAYNLTLRTGAMDSIKKMLAGVSTD… |
| A0A4D0AH75 | 35-240 | None |
| A0A0D2HQU1 | 7-233 | None |
| A0A7S0P860 | 13-267 | None |
| A0A433Q1G4 | 33-307 | None |
| A0A1J0LPE0 | 15-290 | None |
| G4CLV5 | 11-288 | None |
| A0A376KKU3 | 1-204 | None |
| A0A0G4EVG6 | 74-347 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.