DPCstruct | MC3580
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 145 ± 17 aa |
| Standard deviation of domain lengths | 16.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y0L8V4 | 4-135 | PNSATLQWAQRVLEGLNATPTATNMKLASGWIVAEHGWAWNGSGNNPLNTTWKLPGSTNFNNLGNGEGVQNYPSIQEGLQATIDTLT… |
| A0A7W1F7Q3 | 1-172 | MRLQLARAQQVELLAGIARPVRPESPDQGPGLGAAPTPVRWARALLAQIGAPDCQENRLLLVAWQAQESTDARFNPLATTHPMPGAT… |
| A0A522P1N9 | 2-157 | None |
| A0A538LMR5 | 489-620 | None |
| A0A7W1KV99 | 135-301 | None |
| A0A7Y6DMM4 | 18-179 | None |
| A0A1M5N5S7 | 2-136 | None |
| A0A1M5PNV6 | 3-136 | None |
| A0A537VRS6 | 104-245 | None |
| A0A7C3YD31 | 227-346 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.