DPCstruct | MC35792
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 112 ± 15 aa |
| Standard deviation of domain lengths | 14.53 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 42.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF18860 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Q9UVI3 | 2-135 | RFLAEMLHPMVRTNLAEVEQLHDFLNRTLVHDGHEIVQVDTSGAPVFAGRRIGAGVRGSMTNLIFAADGPKPKIVFSDALNNDFRVV… |
| A6T1V3 | 1-94 | MIFASTGPKPEIVIQDAINNDIRIVRNEEHCLVYDRPMQASGLTKEEMLSWWKERQGTEDESDARRSLSQRLMASLASDGERNVFSV… |
| A0A7W3LRF6 | 263-367 | None |
| A0A652NWK0 | 1-117 | None |
| A0A1H0DXJ5 | 130-234 | None |
| A0A4R2JDS6 | 86-189 | None |
| A0A7X6CMJ8 | 199-348 | None |
| A0A240U4V8 | 235-342 | None |
| A0A7J5DYL2 | 89-186 | None |
| A0A5M3WFW4 | 311-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.