DPCstruct | MC35790
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 58 ± 7 aa |
| Standard deviation of domain lengths | 7.40 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 93.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 57.75 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0M3C3V7 | 2-61 | SSKIIYTKTDEAPLLATYSFLPIVQAFAKTADIDVELRDISLAGRILANFSDVLSADQKV |
| X8A9Z0 | 2-70 | SAEKPTVIYTLTDEAPLLATYAFLPIVRAFAEPAGIEIKTSDISVAARILAEFPEHLTEEQRVRTTSRS |
| A0A3B9C8Q9 | 2-71 | None |
| A0A533IVN4 | 1-41 | None |
| A0A482S7K5 | 2-54 | None |
| A0A537N5K4 | 2-63 | None |
| A0A7S4E7W1 | 131-183 | None |
| A0A7R7HPA7 | 2-63 | None |
| A0A2Z5QRA8 | 19-77 | None |
| W4U696 | 1-50 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.