DPCstruct | MC3579
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 164 ± 22 aa |
| Standard deviation of domain lengths | 21.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 79.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 24.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A547QB12 | 177-353 | LSALRERWAAQNRNWMRVVHLMVNILLVLFVVIFCLTLVRSNYVSAFGFNAKEMTLASMMGAVGALFSTTVGLRNMAVDPSVRMIVH… |
| A0A5N1J1M7 | 178-336 | LALLISAAFLPKLALLDFSYAVPPILIVIYAGAMGGLISMLQRYNNLPREGDPINSIPGLMQYWSRMFIPAINGAFFAALLYIILIG… |
| A0A7X8FUL6 | 3-125 | None |
| A0A1G9RDQ4 | 134-321 | None |
| V5E1I0 | 24-216 | None |
| A0A4U0ZMZ1 | 20-167 | None |
| A0A2I8EZH8 | 13-174 | None |
| A0A1H3ZDF0 | 148-343 | None |
| A0A2N7G9R1 | 68-203 | None |
| A0A560KXF6 | 4-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.