DPCstruct | MC35785
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 182 ± 24 aa |
| Standard deviation of domain lengths | 24.07 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 70.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 35.53 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0445- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821AAE8 | 1-157 | MITSLIASTCIFTDRGHGLFMCSPTEIQKLSIASDVKEQISEMLCELYDPSIAMPEAPKQNFFAKIFASNTSLDSDQLFGEAAGKAP… |
| A0A7J5YQI1 | 13-161 | QLAPLLDVNYLPLTDMRIARTFCFSHLGQALYLTSPTEIQRLTYSQDTCEHRQEMLSELFTAVETPEAPNRGFFKGLFGGGAQSLDR… |
| A0A2J7PPU8 | 1001-1207 | None |
| A0A4U5P9N9 | 281-475 | None |
| A0A818IJ04 | 766-976 | None |
| A0A5K3FQU1 | 246-435 | None |
| A0A0N4V9J2 | 34-232 | None |
| A0A2J7PPV2 | 707-831 | None |
| A0A5N3WMC4 | 828-1034 | None |
| A0A1I8ICF8 | 614-777 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.