DPCstruct | MC35784
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 89 ± 5 aa |
| Standard deviation of domain lengths | 5.31 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 79.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 55.76 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0234 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5YLV2 | 1-78 | MSGWRYFVCPVEFNNDSNRFQVDCEPSELFQLQDYTLPSVLESFTGWTTLRLYPFQIHSIALSSFASIMGPFGGFFAS |
| A0A7J5YPM0 | 1-94 | MSGWRYFLCPVEFNNDSNRFQVDCEPSELFQLQDYALPSVLESFTGWTDTCSLSPQTMVRLYLFQIHSIALSSFPSIMGPFGGFFAS… |
| A0A7R9E375 | 605-692 | None |
| A0A7R9ADV0 | 208-299 | None |
| V5ICU4 | 54-145 | None |
| A0A2G9SFE2 | 35-118 | None |
| A0A2U9BQW7 | 714-805 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.