DPCstruct | MC35781
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 134 ± 10 aa |
| Standard deviation of domain lengths | 9.94 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 64.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 29.26 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0760 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5YDK9 | 1-132 | MKERAAMNNSFIYIKIPQVPLCVSYKGEKSSVDWKDLNLVLPCLEYHNNTWTWLDFAMAVKRDSRKALVAQMIKEKLRLKPASGSDQ… |
| A0A183HJM7 | 52-177 | AMNGSFRRTNESSHLRDDIDRMKERAQENNVFLYIKIPEVPFIVSYKGNKEKNIEDVDRFQLVFPLCEYHEKNWTWLDLALAIKQRC… |
| O62191 | 2004-2131 | None |
| A0A4P9ZKG5 | 1-132 | None |
| A0A3M6Y0S8 | 2-135 | None |
| A0A813CAJ2 | 91-248 | None |
| A0A816B884 | 1-131 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.