DPCstruct | MC35780
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 131 ± 32 aa |
| Standard deviation of domain lengths | 32.12 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 79.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 66.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5YAX6 | 9-129 | STRLSGVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTSYLDFVEKDKEPGGEKTNNGIHYKLQLLFSNGVRTEQDLY… |
| A0A452FYX1 | 32-147 | GVGLARAHFEKQPPSNLRKSNFFHFVLALYDRQGQPVEIERTAFVGFVEKEKEANSEKTNNGIHYRLQLLYSNGIRTEQDFYVRLID… |
| A0A498NB65 | 1-78 | None |
| A0A139WNP7 | 247-407 | None |
| T1EJB1 | 1-84 | None |
| T1EJY6 | 1-92 | None |
| A0A194PSR7 | 145-305 | None |
| A0A1A9XXC4 | 1-116 | None |
| A0A1B0C1K3 | 2-94 | None |
| A0A3P4PIZ8 | 27-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.