DPCstruct | MC3578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 376 ± 58 aa |
| Standard deviation of domain lengths | 58.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 22.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0175 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F8PGV2 | 25-471 | VTDPGNFDTKNVKSIWRLHLKITDIKKDRLRWNKEWEKALKSLESSDVYRVMSSAWKTVGARERALLETTRAMVLKVQTGAATVTGD… |
| A0A550CP66 | 15-374 | LTFRAKDILDLQNDLALKATQRLHCDGLEQKWRSLTSVQRREFCLEGLFMASTVYGRDMDKRRCWCPDLTLDSLSSEPDTFLSLLSR… |
| K5V128 | 3-382 | None |
| A0A1Y2FZB6 | 74-527 | None |
| A0A5M3N8R8 | 18-381 | None |
| A0A5M3N733 | 49-470 | None |
| A0A5M3N7E6 | 268-636 | None |
| A0A5C3MEE7 | 37-400 | None |
| A0A1E7ESA5 | 174-498 | None |
| A0A284R8L7 | 7-458 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.