DPCstruct | MC35778
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 172 ± 14 aa |
| Standard deviation of domain lengths | 14.24 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 20.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D8Y8Y0 | 279-474 | FLGTKSGRRARVALLGVTVVAYPLVSLLCNGPLVNISFPWRYSVENLPERLRVIAEQEYLRFLAAEKRVPKDAVVRHHLAKSIGDYE… |
| A0A7J5Y295 | 1-170 | MASRILKYAVLLQKYRTPLLITSCGGVFGANMFYHMFPDMTYRQLYQAWSKGEPVTMSEKLQDVFQQVLKDYGISSPDNFSAFASYG… |
| A0A177B014 | 1-194 | None |
| A0A183R885 | 1-163 | None |
| A7RL23 | 5-156 | None |
| A0A3S3NL85 | 171-337 | None |
| A0A0R3TZJ4 | 7-171 | None |
| A0A6V7WAH0 | 27-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.