DPCstruct | MC35771
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 155 ± 17 aa |
| Standard deviation of domain lengths | 16.93 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 79.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C6RTB1 | 1-128 | MPLPPRPFYSPFEIATRWECDVADIIDWAVAGHLHILVLIPPCTIGGRVFSDAVEVAPSDIHLLLRRFDRSSGKVRIMRMRYPGEPE… |
| A0A4V2Z7A1 | 1-148 | MEIEKAYFTLPEILDRWSISEADLIYLAENDKLRLSVRVFGIPLELGDYEETGNGERFRVPWEPSRFSGLLDLYAQDVFQLFRCSEA… |
| H0C2Y6 | 11-198 | None |
| A0A2M8CY68 | 4-149 | None |
| F3WRV2 | 2-159 | None |
| A0A5E4W269 | 47-206 | None |
| A0A843BH16 | 45-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.