DPCstruct | MC35769
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 205 ± 36 aa |
| Standard deviation of domain lengths | 36.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 84.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 41.09 |
| Pfam Score | 99.22 |
| Assigned Pfam label(s) | CL0036- CL0113 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8HFZ7 | 2-204 | EAKEGQTWTPESWKALPIKQQPEYEDNEALAKALAKVQKLPPIVHQMEIEKLKTYLAQACEGKMFLLQGGDCAERFDECCQETIEKK… |
| A0A800FKN9 | 4-156 | WTKDSWKDFNIKHIPEYKDQNELNETLDRLKTFPPLVFAGECKNLKSELAKAVEGKAFLVQGGDCAESFKEFNANNIRDTFRVILQM… |
| A0A3D9LUQ9 | 345-513 | None |
| M7Z6H5 | 2-190 | None |
| M7YGY0 | 1-98 | None |
| A0A3Q0FJ36 | 120-373 | None |
| H6SRE3 | 440-690 | None |
| R9NVV2 | 4-236 | None |
| A0A841BQH0 | 7-190 | None |
| A0A2S4VP28 | 3-254 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.