DPCstruct | MC35768
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 114 ± 10 aa |
| Standard deviation of domain lengths | 10.20 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 73.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03647 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L8HFA7 | 21-152 | EALPTYGMAAATALMGVKGFRSTKSVPSLAAGLGFGTLFGVSGYLLQDPATSGSGRTIALASSLTLAGVMGSRFARTWKLYPAGTMA… |
| A0A4Q4UU27 | 344-442 | EGHLQNIAYVLGALTASGGTIGFVKTGSVPSIAAGLTVGLLYGLGGYRIQSRQPWGVELALLASVVLGGSSIPRAVRLGKPVPTVLS… |
| A0A1E5V1D8 | 85-205 | None |
| A0A2L2SX59 | 359-478 | None |
| A0A834X1S5 | 391-494 | None |
| A0A0G4M712 | 666-772 | None |
| A0A0G4LJA6 | 382-488 | None |
| A0A0G4KRL9 | 1-118 | None |
| A0A813T7T0 | 526-627 | None |
| A0A4Q4YQF8 | 435-556 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.