DPCstruct | MC35767
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 230 ± 21 aa |
| Standard deviation of domain lengths | 21.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 71.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 23.28 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A084BC26 | 1-226 | MPSDAIPEGAQPFVSGVTILPPSSNRVKDALINLNPIGEKPGLFKTWSQAQKHDIHAVMVKDVFRRAGLEYSAFPDAYVDCVAKCAA… |
| G9N1A6 | 126-356 | RIQLKYRTLQKGYKGADAIDTMNLNSDEEQKYCQTLVDGAFQLLRLQPADYPDCFKACVSKCIDTRALKAHKWSYWGGYKDVYVKIK… |
| A0A2T3Z0S0 | 9-264 | None |
| A0A2T4BNG4 | 2-222 | None |
| A0A2P4ZBP3 | 5-189 | None |
| A0A2P4ZAK6 | 1-235 | None |
| A0A0F9ZCN3 | 1-257 | None |
| A0A2H2ZRD4 | 26-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.