DPCstruct | MC35764
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 258 ± 38 aa |
| Standard deviation of domain lengths | 37.89 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 16.73 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C0EH42 | 149-379 | DTGENYSYSFPVGSYSTNEKLRPCFVSVQSAQQENESFLSVVFHNYSDLPVGEISVDVEIKNEQNETMYFPGLQFRNLRTADRRIES… |
| V2Y7S1 | 1-245 | MHEIYSKLFALPENLYSVGAPVVIAAGALQKDNQTGKVLAQLKIRNIQDKVIKALTVKLTPFDTVGKPLGGTVDYQYLDLAAARDAD… |
| A0A1Y4TL77 | 2-203 | None |
| A0A413S2D6 | 77-397 | None |
| A0A1C6I154 | 1-264 | None |
| A0A7Y8M077 | 12-205 | None |
| A0A1I0EMA5 | 14-287 | None |
| A0A7Y3XXX2 | 61-274 | None |
| A0A3D2G0M4 | 1-252 | None |
| A0A3R6R029 | 1-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.