DPCstruct | MC3576
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 237 ± 40 aa |
| Standard deviation of domain lengths | 39.50 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 86.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 13.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08878 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L5NI06 | 13-236 | YDRPHLEAQQLSDYRDDAKMDGKWGELILFTMVEGFLDIPMMSHKLGWKQNPTDQVKGSDGLFFGKYEGSPTLGIGEAKMYTNLDDG… |
| A0A2A4XT36 | 18-249 | HDFTMLVTIDGGHEIGVDLVSKIVPTHYVSNEKYARMLKMLGKPSAAKYLQTKMPLKKRGRSGDLGEILAITYVKENTIWDQMVEKL… |
| A0A2R4TD30 | 2-254 | None |
| A0A2K8U4C1 | 16-250 | None |
| A0A7Z6XDY7 | 19-221 | None |
| A0A116MME4 | 17-219 | None |
| A0A5E7Q924 | 2-209 | None |
| A0A4V2R9Y7 | 7-195 | None |
| A0A7I8C8A0 | 2-165 | None |
| A0A108T407 | 6-211 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.