DPCstruct | MC35756
Metacluster Properties and Pfam Annotations
| Number of structural domains | 71 |
|---|---|
| Mean domain length (aa) | 134 ± 17 aa |
| Standard deviation of domain lengths | 17.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.48 |
| Pfam Score | 98.89 |
| Assigned Pfam label(s) | CL0123- CL0288 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HM00 | 5-143 | IHRILETSLFDLEQIVTVQYLSRHADISIDDAKDELAEFLMQNKNRTELHAVYVLSGKLKVPDFGSDNTSDTAITPKYRTQLVRDCD… |
| A0A803YPC9 | 6-128 | YLENIDEFVTDQNRIVTYKWLSYTLGVHVNQAKQMLYDYVERKRKENSGAQLHVTYLVAGNLTQNGHTCHKVAVVREDKLEAVKSKL… |
| F4Q9X7 | 12-165 | None |
| A0A7R9KT84 | 4-150 | None |
| A0A6I9Q1Z3 | 2-150 | None |
| A0A4Q4VS81 | 1-121 | None |
| A0A5A7VHS8 | 393-541 | None |
| A0A0N4ZSZ4 | 2-137 | None |
| A0A2C5YYI5 | 1-112 | None |
| K3WL94 | 8-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.