DPCstruct | MC35754
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 77 ± 2 aa |
| Standard deviation of domain lengths | 1.51 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 85.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 56.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P7N0R1 | 1-80 | MEVKVSSPDYPERNRDSVMEDFLKRIECYKVTYQPLDPDEHDKNLSFIQIMNVGQRFLVNRVQDYIQSKIVYYLMNIHVH |
| A0A183HLH5 | 1-77 | MTEEKAKEDFLKRIENYKLQYQPIDDELDNDLSFIKVINAGRSFFVHNVNGHVQSRVVYFLMNIHLLPRSIYLTRVN |
| A0A0F8AZK1 | 91-166 | None |
| A0A1Y3ENH8 | 338-415 | None |
| T1FR44 | 88-162 | None |
| A0A2B4SR09 | 29-106 | None |
| A0A7E4RGE5 | 1-79 | None |
| A0A0F8AKB5 | 447-523 | None |
| D8M406 | 135-209 | None |
| A0A673J961 | 151-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.