DPCstruct | MC35752
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 80 ± 10 aa |
| Standard deviation of domain lengths | 10.45 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 57.07 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05018 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B0X6J4 | 1-78 | MPLALTPGWNQIQFNLADFTRRAYGTNYVETVKIQIHANVRVKRVYFSDRLYPDDELPANLRLHPPLRPLKIGQVYRK |
| A0A183HJV8 | 1-83 | MPMRLDEGWNQIQFNLADFTKRAYGTAYVETLRIQIHANCRIRRIYFADRLYSEDELPAEFKLYLPIKSGAQGTGSSPTSDDD |
| A0A094ZK16 | 1-80 | None |
| A0A0P1AQS5 | 49-113 | None |
| A0A7I4DWX6 | 6-107 | None |
| A0A3P6F5M0 | 1-68 | None |
| A0A194QCX0 | 1-80 | None |
| A0A182GKY0 | 1-74 | None |
| H9J3D9 | 1-96 | None |
| A0A182EWC8 | 1-80 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.