DPCstruct | MC35751
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 175 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 77.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.33 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14744 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A817Z8E5 | 219-387 | HYIFAALRDCISSLRAIRHDKPEKLIKTYKNEIMKMFDQFFLQELFKTIEDDLRCLCHAHLEVGDRSVFRSNFKDVTPFLDVKPIRC… |
| A0A183HKN6 | 1-188 | LQLFFDAINDIETILGSDESELDTRVKESIRDELYELYEKSYLKNLCEAVETDLRLTVHSHLQLDDRRPKDPMHDTNMRLINLLKIP… |
| A0A0A9VAF3 | 171-355 | None |
| A0A482SGZ3 | 219-395 | None |
| A0A6G3MIC4 | 1-159 | None |
| A4I0W7 | 865-1056 | None |
| K1PKW3 | 798-958 | None |
| J9E859 | 111-296 | None |
| A0A5S6Q1S3 | 211-359 | None |
| A0A3Q4MTD8 | 206-376 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.