DPCstruct | MC35750
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 261 ± 42 aa |
| Standard deviation of domain lengths | 41.53 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10266 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P4W0K6 | 65-389 | QAAVKKDPSHVARLRAVFLKLSSGLDLPLLRINQARSPDLISVSAYYSGELVSYVRKVLQIIPETMFGLLAKIIKLQTEKIKEVPTR… |
| A0A183HKF0 | 1-255 | MKSLVKTDPLPVRSLFVKIASSIKLTLERLNTPERISSISMCYSRLIETRLREILQAVPSSLFALLDKVAGLLNPPQGRSINKTDVR… |
| A0A0D8XC99 | 160-346 | None |
| A0A1I8H261 | 139-467 | None |
| A0A158QPT0 | 198-431 | None |
| A0A4W5JQ75 | 1-265 | None |
| A0A6A4IHW2 | 349-610 | None |
| A0A6G0V023 | 495-743 | None |
| A0A6V7VKZ5 | 517-757 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.