DPCstruct | MC3575
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 300 ± 72 aa |
| Standard deviation of domain lengths | 71.90 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 80.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.92 |
| Pfam Score | 97.22 |
| Assigned Pfam label(s) | PF02470- CL0649 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R1LYR3 | 3-377 | DHQDIPEAVVTPKERLSIIWLLPLVAVAIGAWLFYKSQAEADIPVLIHFPTGQGLVAGKTEVRYQGIPIGLVEEFELDTDLDGVVAK… |
| A0A2N7QMY7 | 11-262 | TGLFIVLGFAALGYLATQTTSVANTSRGPSYIVEAHFANIGQLKERAPVKVAGVRIGQVQSIVLDPGKETADVKLSIDKRYDQIPDN… |
| A0A0B8NYA0 | 3-285 | None |
| A0A2N9YA63 | 8-330 | None |
| A0A3S4JAN9 | 456-767 | None |
| A0A4U9HCJ7 | 41-225 | None |
| M1PHR4 | 86-434 | None |
| A0A4R1IFA7 | 22-290 | None |
| A0A142WPX8 | 227-492 | None |
| A0A7Y2KX90 | 130-481 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.