DPCstruct | MC35749
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 91 ± 23 aa |
| Standard deviation of domain lengths | 23.16 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 70.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 37.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HI40 | 1-93 | MNNHCGTDGTDDRIFSELSADNEDVTPMEVESLCVNCHQNGITRILCTRIPFYRQIIVMSFSCAHCGYSNNELQSGEAAQVRSLDSP… |
| A0A391NT09 | 1-66 | MVLSIDPNKVSVIDSECRACGQAGQMRILPTNIPNFREIILMSFACPHCGHTENDVQEAAELGVGA |
| B8PDF1 | 19-92 | None |
| A0A2C5YLZ4 | 1-109 | None |
| A0A0F7SJA8 | 508-631 | None |
| A0A0G4MT58 | 3-80 | None |
| A0A6A5DCL2 | 434-558 | None |
| A0A453DKH3 | 31-122 | None |
| A0A507CW64 | 1-78 | None |
| A0A6A4KEC1 | 234-362 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.