DPCstruct | MC35744
Metacluster Properties and Pfam Annotations
| Number of structural domains | 62 |
|---|---|
| Mean domain length (aa) | 207 ± 26 aa |
| Standard deviation of domain lengths | 26.37 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 80.27 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 20.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183HGJ2 | 8-237 | KSVSRYLHDENAFDMDNELRKAAAMFLRNAIGRILADRDIKKKEHAQLRKACEQAIEELSADRMNEDQGVTTNVLPSKAQYIYADRY… |
| A0A821ZZB1 | 6-192 | SDSHSILQKLINNLSSDLRQLSTETKKKYPPIKEAAEACNMKLREYSTMKDNLSTVMRDASVDLLQPFVLGCDTKQVKIVQLCLTSI… |
| A0A0E0J2P7 | 2-172 | None |
| Q7K783 | 14-251 | None |
| A0A167XC62 | 3-204 | None |
| A0A3Q0J0I0 | 9-218 | None |
| D7KCT8 | 8-183 | None |
| A0A446N5W3 | 8-218 | None |
| A0A3P7DC22 | 7-244 | None |
| R7ULJ2 | 16-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.